PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G274600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 305aa    MW: 32950 Da    PI: 6.3532
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G274600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.61.8e-072532862154
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         k +yp+++++++L +++gL+ +q+ +WF N+R +
  Brast04G274600.2.p 253 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 286
                         469*****************************87 PP

2ELK26.81.1e-09207228122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK +L+++Y+++L+++++E++
  Brast04G274600.2.p 207 ELKSELKQGYKEKLVDIREEIM 228
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-184488IPR005540KNOX1
PfamPF037901.7E-154784IPR005540KNOX1
SMARTSM012567.6E-2696151IPR005541KNOX2
PfamPF037914.5E-16104150IPR005541KNOX2
PROSITE profilePS512139.83207227IPR005539ELK domain
PfamPF037895.1E-6207228IPR005539ELK domain
SMARTSM011888.3E-4207228IPR005539ELK domain
PROSITE profilePS5007111.515227290IPR001356Homeobox domain
SuperFamilySSF466891.41E-15229291IPR009057Homeodomain-like
SMARTSM003892.5E-10229294IPR001356Homeobox domain
CDDcd000866.14E-11230289No hitNo description
Gene3DG3DSA:1.10.10.605.6E-24234290IPR009057Homeodomain-like
PfamPF059208.3E-18247286IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSFHYPDHGL AMDAAAAAAA AASSPNPSFS PGGGGVGLGV GGGEREKAAV AAHPLYERLL  60
EAHVACLRVA TPVDQLPRID AQIAARPPPL VAAAGSAGGP SGGEELDLFM THYVLLLCSF  120
KEQLQQHVRV HAMEAVMGCW ELEQSLQSLT GASPGEGTGA TMSDDEDNQV DSETNLFDGN  180
DGSDGMGFGP LILTEGERSL IERVRHELKS ELKQGYKEKL VDIREEIMRK RRAGKLPGDT  240
AATLKAWWQA HSKWPYPTED DKARLVQETG LQLKQINNWF INQRKRNWHS SNASSSSEKT  300
KKKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1283303RKRNWHSSNASSSSEKTKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570788.10.0PREDICTED: homeobox protein knotted-1-like 2 isoform X2
SwissprotQ0E3C30.0KNOS2_ORYSJ; Homeobox protein knotted-1-like 2
TrEMBLI1HY070.0I1HY07_BRADI; Uncharacterized protein
STRINGBRADI3G06170.30.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-135KNOTTED1-like homeobox gene 3